Everything below concerns Nucleotide. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-10-24. Numbers and descriptions here follow the published literature rather than marketing material.
NMN is generally handled as a hygroscopic and light-sensitive solid in laboratory settings. Recommended storage is typically at -20°C or below, often under desiccation and protected from light. Aqueous solutions are less stable than the solid and may degrade through hydrolysis or other pathways, so fresh preparation is common for analytical work. Repeated freeze-thaw cycles can reduce sample integrity. Stability depends on pH, temperature, buffer composition, and the presence of metal ions, so specific shelf-life values should be determined experimentally rather than assumed.
Quality control for NMN samples often includes purity determination by HPLC, identity confirmation by mass spectrometry or NMR, and water content measurement by Karl Fischer titration. Certificates of analysis may report residual solvents, heavy metals, and microbial limits depending on the intended use. Purity values are method-dependent, so a stated percentage should be interpreted alongside the analytical procedure and detection wavelength. Reference standards help ensure that retention times and spectral data are comparable across laboratories. Researchers increasingly request independent verification because supply chains for specialty chemicals can vary in documentation.
Common laboratory methods for NMN include high-performance liquid chromatography with ultraviolet detection, liquid chromatography coupled to mass spectrometry, and nuclear magnetic resonance spectroscopy. Because the nicotinamide ring absorbs ultraviolet light, HPLC-UV at wavelengths near 260 nm can be used for purity assessment. LC-MS and LC-MS/MS provide greater sensitivity and are often applied to biological samples. Identification typically relies on matching retention time, mass-to-charge ratio, and fragmentation pattern to a reference standard.
NMN is present in small amounts in some foods, including certain vegetables, fruits, and animal products, but food content varies widely and is not well standardized. In laboratory research, NMN is used as a tool compound to study NAD+ metabolism, mitochondrial function, and cellular stress responses. Animal studies have reported changes in NAD+ levels and various physiological measures after NMN administration, but species differences and study designs limit direct extrapolation to humans. Human trials have largely focused on safety, tolerability, and pharmacokinetics, with fewer studies examining clinical endpoints.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide. Its structure consists of a nicotinamide ring attached to a ribose sugar that carries a phosphate group. The molecular formula is C11H15N2O8P, and the molar mass is about 334.22 grams per mole. In cells, NMN is an intermediate in the salvage pathway that recycles nicotinamide to maintain NAD+ levels. It is not the same compound as NAD+, although it is a direct precursor in one enzymatic step.
| Property | Value | Notes |
|---|---|---|
| Solubility | Water-soluble | Polar nucleotide |
| Typical storage | -20°C or below | Desiccated, protected from light |
| Common analytical method | HPLC-UV | Detection near 260 nm |
| Identity confirmation | LC-MS or NMR | Compared with reference standard |
| Purity assessment | HPLC peak area | Method-dependent |
Regulatory treatment of NMN varies by jurisdiction and has changed over time. Some countries allow it in dietary supplements, while others treat it as a novel food ingredient requiring safety review. In the United States, the Food and Drug Administration has questioned whether NMN can be lawfully marketed as a dietary supplement because of drug preclusion provisions. Sports organizations have separate rules, and NMN is not currently on the World Anti-Doping Agency prohibited list. These differences create uncertainty for manufacturers, retailers, and researchers seeking consistent legal pathways.
Nicotinamide mononucleotide is usually handled as a dry powder because moisture can promote hydrolysis and shorten shelf life. Recommended storage conditions often include a desiccated container at minus twenty degrees Celsius or colder, with protection from light. Aqueous solutions are less stable than solid material and may degrade faster at ambient temperature or neutral pH. Repeated freeze-thaw cycles can introduce variability, so aliquoting is common in laboratory settings. These practices reflect general nucleotide chemistry rather than a single universal protocol.
Natural sources of NMN include mammals, plants, and microorganisms, where it functions as an intermediate in NAD+ salvage and biosynthesis pathways. In mammals, the enzyme nicotinamide phosphoribosyltransferase produces NMN from nicotinamide and phosphoribosyl pyrophosphate. NMN is then converted to NAD+ by nicotinamide mononucleotide adenylyltransferase. Some foods contain measurable NMN, but reported amounts vary widely by species, tissue, and analytical method. The extent to which dietary NMN contributes to cellular NAD+ pools remains an open research question.
Chemically, NMN is described by the molecular formula C11H15N2O8P and a molecular mass near 334.22 g/mol. The beta anomer has a CAS Registry Number of 1094-61-7. It is typically supplied as a white to off-white powder for laboratory use. The molecule carries a phosphate group and a positively charged nicotinamide ring, giving it polar and water-soluble character. These properties influence how it is detected, purified, and stored in research and analytical laboratories.
Nicotinamide mononucleotide, abbreviated NMN, is a nucleotide composed of nicotinamide, ribose, and phosphate. Its structure links nicotinamide to D-ribose 5-phosphate through a glycosidic bond, placing it in the pyridine nucleotide family. The compound exists in alpha and beta anomeric forms, and the beta form is the one used in NAD+ biosynthesis. NMN is not a protein or a hormone; it is a small water-soluble molecule that occurs in living cells as a metabolic intermediate.
Laboratory identification of NMN usually relies on chromatographic separation coupled with ultraviolet or mass spectrometric detection. High-performance liquid chromatography with UV absorbance can quantify the compound against a reference standard, while liquid chromatography-tandem mass spectrometry offers lower detection limits and better specificity in complex matrices. Nuclear magnetic resonance spectroscopy can confirm structural identity and isomeric form. Ion chromatography or capillary electrophoresis may be used to identify counterions such as sodium. Method validation includes accuracy, precision, linearity, and limits of detection.
Stability testing examines how temperature, humidity, light, and pH affect NMN over time. The compound is generally stored cold, often at minus twenty degrees Celsius or lower, in a desiccated container protected from light. Aqueous solutions tend to be less stable than dry powder because hydrolysis and dephosphorylation can occur, potentially forming nicotinamide riboside or other degradation products. Stress studies may expose samples to heat, acid, base, oxidation, and strong light to identify likely degradation pathways. Results from such studies help define shelf life and handling recommendations, though exact stability depends on formulation and packaging.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring with a ribose sugar and a phosphate group. The compound appears in cells across many organisms as an intermediate in the production of nicotinamide adenine dinucleotide, or NAD+. Because NMN sits close to NAD+ in metabolism, it has drawn interest in biochemistry and aging research. The molecule is not a dietary essential nutrient in the classical sense, and its presence in food is generally low and variable.
NAD+ serves as a coenzyme in redox reactions and as a substrate for enzymes involved in DNA repair and cellular signaling. In the salvage pathway, nicotinamide is converted to NMN by the enzyme NAMPT. NMN is then converted to NAD+ by NMNAT enzymes. A separate route links nicotinamide riboside to NMN through phosphorylation. These pathways maintain NAD+ levels, which can decline with age or metabolic stress in some tissues. The relative contribution of circulating NMN to tissue NAD+ remains an active area of study.
Research on NMN includes cell studies, animal experiments, and a growing number of human trials. Many early findings come from mice, where changes in NAD+ levels and metabolic markers have been reported. Human data are more limited, and questions remain about effective routes of administration, tissue distribution, and long-term effects. Some trials measure NAD+ in blood or tissue, while others assess physical function or metabolic outcomes. Regulatory status differs between countries, and NMN is not universally approved as a dietary supplement or therapeutic agent.
=== Backing === Since finer turquoise is often found as thin seams, it may be glued to a base of stronger foreign material for reinforcement. These stones are termed "backed", and it is standard practice that all thinly cut turquoise in the Southwestern United States is backed. Native indigenous peoples of this region, because of their considerable use and wearing of turquoise, have found that backing increases the durability of thinly cut slabs and cabochons of turquoise. They observe that if the stone is not backed it will often crack. Backing of turquoise is not widely known outside of the Native American and Southwestern United States jewellery trade. Backing does not diminish the value of high quality turquoise, and indeed the process is expected for most thinly cut American commercial gemstones.
Despite initial successes, however, Gericke realized that the time was not yet ripe for the general technical application and commercial use of hydroponics for producing crops. He also wanted to make sure all aspects of hydroponic cultivation were researched and tested before making any of the specifics available to the public. Reports of Gericke's work and his claims that hydroponics would revolutionize plant agriculture prompted a huge number of requests for further information. Gericke had been denied use of the university's greenhouses for his experiments due to the administration's skepticism, and when the university tried to compel him to release his preliminary nutrient recipes developed at home, he requested greenhouse space and time to improve them using appropriate research facilities. While he was eventually provided greenhouse space, the university assigned Hoagland and Arnon to re-evaluate Gericke's claims and show his formula held no benefit over soil grown plant yields, a view held by Hoagland. Because of these irreconcilable conflicts, Gericke left his academic position in 1937 in a climate that was politically unfavorable and continued his research independently in his greenhouse. In 1940, Gericke, whose work is considered to be the basis for all forms of hydroponic growing, published the book, Complete Guide to Soilless Gardening. Therein, for the first time, he published his basic formulas involving the macro- and micronutrient salts for hydroponically grown plants.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Portugal's road network includes a system of 48 motorways, which, as of 2023, ranked as the seventh largest among 42 European countries. The busiest Portuguese airports are Lisbon Airport, Porto Airport, Faro Airport, Madeira Airport, and Ponta Delgada Airport. As of 2024, passenger and freight rail transport in Portugal operated on 2,526 km (1,570 mi) of active railway lines, with passenger services operated mainly by Comboios de Portugal (CP). The Port of Sines serves as Portugal's foremost container port and leads the country in cargo tonnage. As of 2023, two-thirds of Portugal's energy supply was imported, representing the 11th-highest level of energy dependency in the European Union. The country is pursuing energy transition and has invested in the development of renewable energy sources such as the Aguçadoura Wave Farm. Portugal has expanded the role of renewable sources in its energy sector, with renewables accounting for 35.2% of energy consumption, as of 2023 up from 21.9% in 2007, and 78.1% of total installed capacity, compared with 59.3% in 2014. In 2021, the country completed the phase-out of coal-fired generation.
=== Treatment === Treatment of ibotenic acid toxicity centres around supportive care and treatment of symptoms; no antidote is available. Gastric decontamination with activated charcoal or gastric lavage can be of benefit if the patient presents early. The psychotropic effects and hallucinations ibotenic acid and its metabolite muscimol produce are best managed in a quiet environment with minimal stimulation. Benzodiazepines can be of benefit in agitated or panicked patients; they can also be used to control seizures if they occur. Benzodiazepines as a GABA-A PAM interacts with Muscimol as a GABA-A agonist and may cause a significantly increased risk of depressant effects. Airway management may be required if sedation is profound. Symptoms usually resolve within a few hours of ingestion but can last for days following significant exposures. Monitoring for the presence of brain lesions may be required following a large or repeated exposure. Other measures may be required if the patient has been exposed to a mushroom such as Amanita muscaria as other active compounds may be present.
Sources: en.wikipedia.org
=== Generic names === Estradiol cypionate is the generic name of the drug and its INNTooltip International Nonproprietary Name and USANTooltip United States Adopted Name. It is also known as estradiol cyclopentylpropionate (ECP).
The Department was founded in 1934 in Kazan Teachers’ Institute to educate future teachers of chemistry. In November, 2011 the Department of Chemical Education became a structural unit of A. M. Butlerov Institute of Chemistry of Kazan (Volga Region) Federal University. Educational research was combined with fundamental and applied research in chemistry. International, All-Russian and regional research-to-practice conferences on chemical education organized by the Department are of the utmost interest. The Department has received letters of gratitude from school principals for instructing students in research and methodology in their preparation for teaching practice. Today 3 Doctors of Science and 5 Doctors of Philosophy are involved in the educational and bringing-up process at the Department. Since 2010 teachers have been retrained in the field of “Teacher of Chemistry”.The head of the Department is Suria I. Gilmanshina, Doctor of Philosophy in Chemistry, Doctor of Science in Education. The Department conducts research in the following fields:
Plant breeding started with sedentary agriculture and particularly the domestication of the first agricultural plants, a practice which is estimated to date back 9,000 to 11,000 years. Initially early farmers simply selected food plants with particular desirable characteristics, and employed these as progenitors for subsequent generations, resulting in an accumulation of valuable traits over time. Grafting technology had been practiced in China before 2000 BCE. By 500 BCE grafting was well established and practiced. Gregor Mendel (1822–84) is considered the "father of genetics". His experiments with plant hybridization led to his establishing laws of inheritance. Genetics stimulated research to improve crop production through plant breeding. Selective breeding played a crucial role in the Green Revolution of the 20th century. Modern plant breeding is applied genetics, but its scientific basis is broader, covering molecular biology, cytology, systematics, physiology, pathology, entomology, chemistry, and statistics (biometrics). It has also developed its own technology.
A22, also known as S-(3,4-dichlorobenzyl) isothiourea, is a chemical compound with antibiotic activity. It is colorless, hygroscopic, and light-sensitive. A22 acts as a reversible inhibitor of the bacterial cell wall protein MreB, causing bacterial rod-shaped cells to form coccoid cells. The antibiotic activity of A22 has been studied primarily in Pseudomonas aeruginosa. However, A22 does not seem to be useful as an antibiotic in humans due to its cytotoxic and genotoxic effects on human peripheral blood mononuclear cells (PBMCs). Despite its cytotoxic effects in human cells, A22 has been used as a research tool to investigate the bacterial cytoskeleton. A22 binds directly to the actin homolog MreB in its nucleotide-binding pocket, blocking simultaneous ATP binding. As a consequence, A22 inhibits MreB polymerization and thus disrupts the cytoskeleton of bacteria, causing defects of morphology and chromosome segregation.
==== Transistors ==== Bismuth-based materials have been claimed to enable smaller, faster, and more energy-efficient transistors than traditional silicon. Bismuth offers a small bandgap and high electron mobility. It has topological insulator states, conducting along its surface/edges while still insulating internally. Two-dimensional semiconductor (2D) materials can be produced from it, enabling thinner and higher-performance devices. Such 2D bismuth materials support subnanometer channel lengths, surpassing silicon's practical limits. However, bismuth's anisotropic heat transport can complicate chip design. Bismuth telluride (Bi2Te3) has been investigated for use in thermoelectric transistors that use temperature gradients (e.g., via laser illumination) to generate electricity, yielding 0.7093 μW in experimental setups. They operate by leveraging the Seebeck effect, using a temperature difference to drive charge carrier movement. Bismuth oxyselenides (Bi2O2Se and Bi2SeO5) have been investigated for use in field-effect transistors (FETs). These 2D materials exhibit high electron mobility (e.g., 10–15 cm2/(V·s)) and stability in air. One study reported that these materials enabled transistors that were 40% faster and 10% more efficient than Intel's 3 nm chips. Bismuth can reduce contact resistance when paired with 2D semiconductors such as MoS2. This eliminates the Schottky barrier—a common efficiency issue in metal-semiconductor interfaces.
Sources: en.wikipedia.org
NMN is commonly detected by HPLC-UV, LC-MS, or LC-MS/MS. These methods separate the compound from related substances and identify it by retention time and mass.
Laboratory samples are typically stored at -20°C or below, protected from light and moisture. Solutions are usually prepared fresh because they can degrade more quickly than the solid.
Purity depends on the analytical method, detection wavelength, and integration parameters. A value from one laboratory may not be directly comparable to another without method details.
NMN stands for nicotinamide mononucleotide. It is a nucleotide intermediate in the cellular pathway that produces NAD+, a coenzyme involved in energy metabolism and signaling. NMN is not the same compound as NAD+.